PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_10125.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 350aa    MW: 39128.9 Da    PI: 8.056
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_10125.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM147.66.3e-46161421128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelv +yLkkkv++ ++++ ++i+evd+yk++Pw+Lp  +         F +++ ky++g r+nra++sgyWkat
  Sme2.5_10125.1_g00001.1  16 LPPGFRFHPTDEELVIHYLKKKVAAAPIPV-DIIAEVDLYKFDPWELPGWYLI-YAAKAIFGEQEWKYPNGARPNRAATSGYWKAT 99 
                              79****************************.99***************53322.34556899************************ PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk+v+++ ++++vg+kk Lvfy g+ pkg kt+W+mheyr+
  Sme2.5_10125.1_g00001.1 100 GTDKPVFTSgGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRV 142
                              *******9977788***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5411177IPR003441NAC domain
PROSITE profilePS5100554.16516177IPR003441NAC domain
PfamPF023652.9E-2417142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MESTDSSTGT RHQPQLPPGF RFHPTDEELV IHYLKKKVAA APIPVDIIAE VDLYKFDPWE  60
LPGWYLIYAA KAIFGEQEWK YPNGARPNRA ATSGYWKATG TDKPVFTSGG TQKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RVAENKTNNK PPGCEVVANK KGSLRLDDWV LCRIYKKSNT  180
QRPIDDMNDI LGPIVPQCVP NSILQGIKSS NYGTLLENES NMYDGIMNNT SDMISYNNGS  240
NIPQLSSKRS MHAGNLYWNI DEATTTATGG NNSPNTKRFL VDNNEDDGFN MNNIAQITNH  300
EQSSSIANFL SQFPQNPSIQ QPQQQALGSL SDGVVFRQPY NQVTSMHWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-6211806168NO APICAL MERISTEM PROTEIN
1ut4_B2e-6211806168NO APICAL MERISTEM PROTEIN
1ut7_A2e-6211806168NO APICAL MERISTEM PROTEIN
1ut7_B2e-6211806168NO APICAL MERISTEM PROTEIN
3swm_A2e-6211809171NAC domain-containing protein 19
3swm_B2e-6211809171NAC domain-containing protein 19
3swm_C2e-6211809171NAC domain-containing protein 19
3swm_D2e-6211809171NAC domain-containing protein 19
3swp_A2e-6211809171NAC domain-containing protein 19
3swp_B2e-6211809171NAC domain-containing protein 19
3swp_C2e-6211809171NAC domain-containing protein 19
3swp_D2e-6211809171NAC domain-containing protein 19
4dul_A2e-6211806168NAC domain-containing protein 19
4dul_B2e-6211806168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362947.10.0PREDICTED: NAC transcription factor 56
SwissprotQ9LD442e-92NAC56_ARATH; NAC transcription factor 56
TrEMBLM1CCC70.0M1CCC7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000644280.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18142466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.12e-83NAC domain containing protein 2